| Desktop | 89/100 | ✔ |
| Mobile | 86/100 | ✔ |
| Field | Data | Result |
|---|---|---|
| Page Size | 44 KB | ✔ |
| Compression | 12 KB (-71.6%) | ✔ |
| Text/Html Ratio | 3161 / 44821 (bytes) = 7.05% | ❗ |
| Load Time | 0.26 second | ✔ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 21 | ✔ |
| Doc Type | ✔ | |
| Encoding | UTF-8 | ✔ |
| Declared Language | Unknown | ✘ |
| Preferred Domain | No | ❗ |
| Robots.txt | No | ✘ |
| Url Rewrite | Yes | ✘ |
| Underscores in url | Yes | ✘ | Images Without ALT | 48 / 52 | ✘ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | No | ✘ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | Yes | ✔ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| services | 4 | ✔ | ✔ | ✘ |
| agri | 4 | ✔ | ✔ | ✘ |
| sewage | 3 | ✘ | ✘ | ✘ |
| industrial | 3 | ✔ | ✔ | ✘ |
| domestic | 2 | ✔ | ✔ | ✘ |
| service | 2 | ✔ | ✔ | ✘ |
| wastedisposer | 2 | ✘ | ✘ | ✘ |
| pumps | 2 | ✔ | ✔ | ✘ |
| advanced | 1 | ✘ | ✘ | ✘ |
| techniques | 1 | ✘ | ✘ | ✘ |
| coupled | 1 | ✘ | ✘ | ✘ |
| authorized | 1 | ✘ | ✘ | ✘ |
| wehave | 1 | ✘ | ✘ | ✘ |
| value-added | 1 | ✘ | ✘ | ✘ |
| been | 1 | ✘ | ✘ | ✘ |
|
With 0.26 seconds in page load, 44 KB of page size and all other reports below, the jayalakshmielectricalservice.com has a SEO score of 45 out of 100 |
| Title | AC-DC Electric Motors, Agricultural And Domestic Pumps, Industrial Vacuum Pumps, Three Phase Alternators Services In Chennai, India |
| Description | Jayalakshmi Electrical Services Is Offering Services For AC-DC Electric Motors, Agricultural And Domestic Pumps, Industrial Vacuum Pumps, Three Phase Alternators In Chennai, India. |
| Keyword | Ac-Dc Electric Motors, Agricultural And Domestic Pumps, Industrial Vacuum Pumps, Three Phase Alternators, Ac-Dc Electric Motors,Agricultural And Domestic Pumps Service, Industrial Vacuum Pumps Service, Three Phase Alternators Service, Ac-Dc Electric Motors Service Chennai, Agricultural And Domestic Pumps Service Chennai, Industrial Vacuum Pumps Service Chennai, Three Phase Alternators Service Chennai, Ac-Dc Electric Motors Service Chennai India, Agricultural And Domestic Pumps Service Chennai India, Industrial Vacuum Pumps Service Chennai India, Three Phase Alternators Service Chennai India |
| Age | 0 Years, 3 Days |
| Created | 25th-Jul-2020 |
| Updated | 25th-Jul-2020 |
| Expiry | 25th-Jul-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| jayalakshmielectricalservice.com | A | 589 | ip:43.255.154.32 |
| jayalakshmielectricalservice.com | NS | 3600 | target:ns68.domaincontrol.com |
| jayalakshmielectricalservice.com | NS | 3600 | target:ns67.domaincontrol.com |
| jayalakshmielectricalservice.com | SOA | 3600 | mname:ns67.domaincontrol.comrname:dns.jomax.netserial:2020072401refresh:28800retry:7200expire:604800minimum-ttl:600 |
|
Domain Name: jayalakshmielectricalservice.com Registry Domain ID: 2548472678_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.wildwestdomains.com Registrar URL: http://www.wildwestdomains.com Updated Date: 2020-07-25T04:58:56Z Creation Date: 2020-07-25T04:58:56Z Registrar Registration Expiration Date: 2021-07-25T04:58:56Z Registrar: Wild West Domains, LLC Registrar IANA ID: 440 Registrar Abuse Contact Email: abuse@wildwestdomains.com Registrar Abuse Contact Phone: +1.4806242505 Reseller: Jio server Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited Registrant Organization: Fortune Webs Registrant State/Province: Telangana Registrant Country: IN Registrant Email: Select Contact Domain Holder link at https://www.secureserver.net/whois?plid=1387&domain=jayalakshmielectricalservice.com Admin Email: Select Contact Domain Holder link at https://www.secureserver.net/whois?plid=1387&domain=jayalakshmielectricalservice.com Tech Email: Select Contact Domain Holder link at https://www.secureserver.net/whois?plid=1387&domain=jayalakshmielectricalservice.com Name Server: NS67.DOMAINCONTROL.COM Name Server: NS68.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2020-07-28T12:00:00Z |
| Server IP | 43.255.154.32 |
| Server Location | Singapore |
| Service Provider | GoDaddy.com, LLC |
| Domains (TLD) | Status |
|---|---|
| jayalakshmielectricalservice.net | Available |
| jayalakshmielectricalservice.org | Available |
| jayalakshmielectricalservice.biz | Already Registered |
| jayalakshmielectricalservice.io | Already Registered |
| jayalakshmielectricalservice.info | Available |
| Domains (TLD) | Status |
|---|---|
| nayalakshmielectricalservice.com | Available |
| hayalakshmielectricalservice.com | Available |
| yayalakshmielectricalservice.com | Available |
| uayalakshmielectricalservice.com | Available |
| iayalakshmielectricalservice.com | Available |
| Jusekesoev.com |
| The1-shop.com |
| Blogdesandra.com |
| Thelandscapeadvisors.com |
| Kolsloveskarl.com |
| Liquidliipo.com |
| Laudatosi.net |
| Dafa383.com |
| Falconmanagementsystem.com |
| The-artifactory.com |